Anti-ADAM28
Artikelnummer:
ATA-HPA074034
- Bilder (8)
| Artikelname: | Anti-ADAM28 |
| Artikelnummer: | ATA-HPA074034 |
| Hersteller Artikelnummer: | HPA074034 |
| Alternativnummer: | ATA-HPA074034-100,ATA-HPA074034-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ADAM23, eMDCII, MDC-Lm, MDC-Ls |
| ADAM metallopeptidase domain 28 |
| Anti-ADAM28 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10863 |
| UniProt: | Q9UKQ2 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ELPGVKKYEVVYPIRLHPLHKREAKEPEQQEQFETELKYKMTINGKIAVLYLKKNKNLLAPGYTETYYNSTGKEITTSPQIMDDCYY |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ADAM28 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & mitochondria. |
|
|
Immunohistochemistry analysis in human epididymis and liver tissues using Anti-ADAM28 antibody. Corresponding ADAM28 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human epididymis shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
HPA074034-100ul |
|
|
|
|
|
HPA074034-100ul |
|
|
HPA074034-100ul |
Produktgarantie und fachkundiger Support
