Anti-ADAM28

Catalog Number: ATA-HPA074034
Article Name: Anti-ADAM28
Biozol Catalog Number: ATA-HPA074034
Supplier Catalog Number: HPA074034
Alternative Catalog Number: ATA-HPA074034-100,ATA-HPA074034-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ADAM23, eMDCII, MDC-Lm, MDC-Ls
ADAM metallopeptidase domain 28
Anti-ADAM28
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 10863
UniProt: Q9UKQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ELPGVKKYEVVYPIRLHPLHKREAKEPEQQEQFETELKYKMTINGKIAVLYLKKNKNLLAPGYTETYYNSTGKEITTSPQIMDDCYY
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ADAM28
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & mitochondria.
Immunohistochemistry analysis in human epididymis and liver tissues using Anti-ADAM28 antibody. Corresponding ADAM28 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human epididymis shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
HPA074034-100ul
HPA074034-100ul
HPA074034-100ul