Anti-LINGO1

Artikelnummer: ATA-HPA074653
Artikelname: Anti-LINGO1
Artikelnummer: ATA-HPA074653
Hersteller Artikelnummer: HPA074653
Alternativnummer: ATA-HPA074653-100,ATA-HPA074653-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ14594, LERN1, LRRN6A
leucine rich repeat and Ig domain containing 1
Anti-LINGO1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 84894
UniProt: Q96FE5
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: LINGO1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line HEK 293 shows localization to plasma membrane.
Immunohistochemistry analysis in human cerebral cortex and liver tissues using Anti-LINGO1 antibody. Corresponding LINGO1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
HPA074653-100ul
HPA074653-100ul
HPA074653-100ul