Anti-LINGO1

Catalog Number: ATA-HPA074653
Article Name: Anti-LINGO1
Biozol Catalog Number: ATA-HPA074653
Supplier Catalog Number: HPA074653
Alternative Catalog Number: ATA-HPA074653-100,ATA-HPA074653-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ14594, LERN1, LRRN6A
leucine rich repeat and Ig domain containing 1
Anti-LINGO1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 84894
UniProt: Q96FE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: LINGO1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line HEK 293 shows localization to plasma membrane.
Immunohistochemistry analysis in human cerebral cortex and liver tissues using Anti-LINGO1 antibody. Corresponding LINGO1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
HPA074653-100ul
HPA074653-100ul
HPA074653-100ul