Anti-OGFOD3, Rabbit, Polyclonal

Artikelnummer: ATA-HPA075059
Artikelname: Anti-OGFOD3, Rabbit, Polyclonal
Artikelnummer: ATA-HPA075059
Hersteller Artikelnummer: HPA075059
Alternativnummer: ATA-HPA075059-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Alternative Synonym: C17orf101, FLJ22222
Rabbit Polyclonal OGFOD3 Antibody against Human 2-oxoglutarate and iron dependent oxygenase domain containing 3. Validated for Western Blot
Klonalität: Polyclonal
Konzentration: 0.05
NCBI: 79701
UniProt: Q6PK18
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Sequenz: SFDYTSLLYLSNYLEDFGGGRFMFMEEGANKTVEPRAGRVSFFTSGSENLHRVEKVHWGTRYAITIAFSCNPDHGIE