Anti-OGFOD3

Catalog Number: ATA-HPA075059
Article Name: Anti-OGFOD3
Biozol Catalog Number: ATA-HPA075059
Supplier Catalog Number: HPA075059
Alternative Catalog Number: ATA-HPA075059-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: WB
Species Reactivity: Human
Alternative Names: C17orf101, FLJ22222
Rabbit Polyclonal OGFOD3 Antibody against Human 2-oxoglutarate and iron dependent oxygenase domain containing 3. Validated for Western Blot
Clonality: Polyclonal
Concentration: 0.05
NCBI: 79701
UniProt: Q6PK18
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Sequence: SFDYTSLLYLSNYLEDFGGGRFMFMEEGANKTVEPRAGRVSFFTSGSENLHRVEKVHWGTRYAITIAFSCNPDHGIE
WB Image Caption 1