Anti-OGFOD3, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-OGFOD3, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA075059
• Supplier Catalog Number: HPA075059
• Alternative Catalog Number: ATA-HPA075059-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Alternative Names: C17orf101, FLJ22222

Product Description

Rabbit Polyclonal OGFOD3 Antibody against Human 2-oxoglutarate and iron dependent oxygenase domain containing 3. Validated for Western Blot

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05
• NCBI: 79701
• UniProt: Q6PK18
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Sequence: SFDYTSLLYLSNYLEDFGGGRFMFMEEGANKTVEPRAGRVSFFTSGSENLHRVEKVHWGTRYAITIAFSCNPDHGIE