Anti-MAGEB2

Artikelnummer: ATA-HPA075519
Artikelname: Anti-MAGEB2
Artikelnummer: ATA-HPA075519
Hersteller Artikelnummer: HPA075519
Alternativnummer: ATA-HPA075519-100,ATA-HPA075519-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CT3.2, DAM6, MAGE-XP-2, MGC26438
MAGE family member B2
Anti-MAGEB2
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 4113
UniProt: O15479
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MAGEB2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500
Immunohistochemistry analysis in human testis and endometrium tissues using Anti-MAGEB2 antibody. Corresponding MAGEB2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney, liver, lymph node and testis using Anti-MAGEB2 antibody HPA075519 (A) shows similar protein distribution across tissues to independent antibody HPA074544 (B).
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human endometrium shows low expression as expected.
Immunohistochemical staining of human lymph node using Anti-MAGEB2 antibody HPA075519.
Immunohistochemical staining of human kidney using Anti-MAGEB2 antibody HPA075519.
Immunohistochemical staining of human liver using Anti-MAGEB2 antibody HPA075519.
HPA075519-100ul
HPA075519-100ul
HPA075519-100ul