Anti-MAGEB2

Product Overview

• Article Name: Anti-MAGEB2
• Biozol Catalog Number: ATA-HPA075519
• Supplier Catalog Number: HPA075519
• Alternative Catalog Number: ATA-HPA075519-100,ATA-HPA075519-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Sonstiges
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CT3.2, DAM6, MAGE-XP-2, MGC26438

Product Description

MAGE family member B2

Additional Information

Anti-MAGEB2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 4113
• UniProt: O15479
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: EGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFP
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: MAGEB2
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:1000 - 1:2500

Images

Immunohistochemistry analysis in human testis and endometrium tissues using Anti-MAGEB2 antibody. Corresponding MAGEB2 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human kidney, liver, lymph node and testis using Anti-MAGEB2 antibody HPA075519 (A) shows similar protein distribution across tissues to independent antibody HPA074544 (B).

Immunohistochemical staining of human testis shows high expression.

Immunohistochemical staining of human endometrium shows low expression as expected.

Immunohistochemical staining of human lymph node using Anti-MAGEB2 antibody HPA075519.

Immunohistochemical staining of human kidney using Anti-MAGEB2 antibody HPA075519.

Immunohistochemical staining of human liver using Anti-MAGEB2 antibody HPA075519.

HPA075519-100ul

HPA075519-100ul

HPA075519-100ul