Anti-ADORA2A
Artikelnummer:
ATA-HPA075997
- Bilder (7)
| Artikelname: | Anti-ADORA2A |
| Artikelnummer: | ATA-HPA075997 |
| Hersteller Artikelnummer: | HPA075997 |
| Alternativnummer: | ATA-HPA075997-100,ATA-HPA075997-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ADORA2, RDC8 |
| adenosine A2a receptor |
| Anti-ADORA2A |
| Klonalität: | Polyclonal |
| Konzentration: | 0.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 135 |
| UniProt: | P29274 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ADORA2A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human bone marrow and skeletal muscle tissues using Anti-ADORA2A antibody. Corresponding ADORA2A RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human bone marrow shows high expression. |
|
|
Immunohistochemical staining of human thymus shows strong membranous and cytoplasmic positivity in medullary cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
HPA075997-100ul |
|
|
HPA075997-100ul |
|
|
HPA075997-100ul |
Produktgarantie und fachkundiger Support
