Anti-ADORA2A
Catalog Number:
ATA-HPA075997
- Images (7)
| Article Name: | Anti-ADORA2A |
| Biozol Catalog Number: | ATA-HPA075997 |
| Supplier Catalog Number: | HPA075997 |
| Alternative Catalog Number: | ATA-HPA075997-100,ATA-HPA075997-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ADORA2, RDC8 |
| adenosine A2a receptor |
| Anti-ADORA2A |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 135 |
| UniProt: | P29274 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ADORA2A |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human bone marrow and skeletal muscle tissues using Anti-ADORA2A antibody. Corresponding ADORA2A RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human bone marrow shows high expression. |
|
|
Immunohistochemical staining of human thymus shows strong membranous and cytoplasmic positivity in medullary cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
HPA075997-100ul |
|
|
HPA075997-100ul |
|
|
HPA075997-100ul |
Product Guarantee and Expert Support
