Anti-GluA2/GluR2 Glutamate Receptor (L21/32) Recombinant Chicken Chimeric mAb (BSA and Azide free), Clone: [L21/32], Unconjugated, Gallus

Produktübersicht

• Artikelname: Anti-GluA2/GluR2 Glutamate Receptor (L21/32) Recombinant Chicken Chimeric mAb (BSA and Azide free), Clone: [L21/32], Unconjugated, Gallus
• Artikelnummer: AVL-78-002-CF
• Hersteller Artikelnummer: 78-002-CF
• Alternativnummer: AVL-78-002-CF
• Hersteller: Aves Labs
• Wirt: Gallus
• Kategorie: Antikörper
• Applikation: ELISA, EM, ICC, IHC, IP, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli
• Konjugation: Unconjugated
• Alternative Synonym: Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)

Produktbeschreibung

Our chicken Anti-GluA2/GluR2 glutamate receptor carrier-free recombinant monoclonal antibody is a chimeric antibody derived from NeuroMab clone L21/32. It detects human, mouse, and rat GluA2/GluR2 is purified by affinity chromatography. It works in WB, IHC, ICC, ELISA.

Produkteigenschaften

• Klonalität: Recombinant
• Konzentration: 1 mg/mL
• Klon-Bezeichnung: [L21/32]
• Molekulargewicht: 90 kDa
• UniProt: P19491
• Puffer: 1
• Formulierung: Liquid
• Target-Kategorie: GluA2/GluR2 glutamate receptor
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: Dilution Range: WB: 1:500-1:1000. Dilution Range: WB Brain: 1:500-1:1000. Dilution Range: IHC: 1:250-1:500. Dilution Range: ICC: 1:500