Anti-GluA2/GluR2 Glutamate Receptor (L21/32) Recombinant Chicken Chimeric mAb (BSA and Azide free), Clone: [L21/32], Unconjugated, Gallus

Product Overview

• Article Name: Anti-GluA2/GluR2 Glutamate Receptor (L21/32) Recombinant Chicken Chimeric mAb (BSA and Azide free), Clone: [L21/32], Unconjugated, Gallus
• Biozol Catalog Number: AVL-78-002-CF
• Supplier Catalog Number: 78-002-CF
• Alternative Catalog Number: AVL-78-002-CF
• Manufacturer: Aves Labs
• Host: Gallus
• Category: Antikörper
• Application: ELISA, EM, ICC, IHC, IP, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli
• Conjugation: Unconjugated
• Alternative Names: Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)

Product Description

Our chicken Anti-GluA2/GluR2 glutamate receptor carrier-free recombinant monoclonal antibody is a chimeric antibody derived from NeuroMab clone L21/32. It detects human, mouse, and rat GluA2/GluR2 is purified by affinity chromatography. It works in WB, IHC, ICC, ELISA.

Product Properties

• Clonality: Recombinant
• Concentration: 1 mg/mL
• Clone Designation: [L21/32]
• Molecular Weight: 90 kDa
• UniProt: P19491
• Buffer: 1
• Form: Liquid
• Target: GluA2/GluR2 glutamate receptor
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: Dilution Range: WB: 1:500-1:1000. Dilution Range: WB Brain: 1:500-1:1000. Dilution Range: IHC: 1:250-1:500. Dilution Range: ICC: 1:500