Recombinant Toxocara canis 26KDA secreted antigen (TES-26), Unconjugated, Yeast

Artikelnummer: BIM-RPC20259
Artikelname: Recombinant Toxocara canis 26KDA secreted antigen (TES-26), Unconjugated, Yeast
Artikelnummer: BIM-RPC20259
Hersteller Artikelnummer: RPC20259
Alternativnummer: BIM-RPC20259-20UG,BIM-RPC20259-100UG,BIM-RPC20259-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Parasite
Konjugation: Unconjugated
Alternative Synonym: Toxocara excretory-secretory antigen 26, TES-26
Recombinant Toxocara canis 26KDA secreted antigen (TES-26) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Toxocara canis (Canine roundworm). Target Name: TES-26. Target Synonyms: Toxocara excretory-secretory antigen 26, TES-26. Accession Number: P54190. Expression Region: 22~262aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 27.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 27.9kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA
Target-Kategorie: TES-26