Recombinant Toxocara canis 26KDA secreted antigen (TES-26), Unconjugated, Yeast

Catalog Number: BIM-RPC20259
Article Name: Recombinant Toxocara canis 26KDA secreted antigen (TES-26), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC20259
Supplier Catalog Number: RPC20259
Alternative Catalog Number: BIM-RPC20259-20UG,BIM-RPC20259-100UG,BIM-RPC20259-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Parasite
Conjugation: Unconjugated
Alternative Names: Toxocara excretory-secretory antigen 26, TES-26
Recombinant Toxocara canis 26KDA secreted antigen (TES-26) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Toxocara canis (Canine roundworm). Target Name: TES-26. Target Synonyms: Toxocara excretory-secretory antigen 26, TES-26. Accession Number: P54190. Expression Region: 22~262aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 27.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 27.9kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA
Target: TES-26