Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC20276
Artikelname: Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC20276
Hersteller Artikelnummer: RPC20276
Alternativnummer: BIM-RPC20276-20UG,BIM-RPC20276-100UG,BIM-RPC20276-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: GLP-1 receptorGLP-1-RGLP-1R
Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Glp1r. Target Synonyms: GLP-1 receptorGLP-1-RGLP-1R. Accession Number: O35659. Expression Region: 22~145aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 30.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 30.4kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY
Target-Kategorie: Glp1r