Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC20276
Article Name: Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20276
Supplier Catalog Number: RPC20276
Alternative Catalog Number: BIM-RPC20276-20UG,BIM-RPC20276-100UG,BIM-RPC20276-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: GLP-1 receptorGLP-1-RGLP-1R
Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Glp1r. Target Synonyms: GLP-1 receptorGLP-1-RGLP-1R. Accession Number: O35659. Expression Region: 22~145aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 30.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 30.4kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY
Target: Glp1r