Recombinant Naja kaouthia Cobra venom factor, Unconjugated, E. coli

Artikelnummer: BIM-RPC20297
Artikelname: Recombinant Naja kaouthia Cobra venom factor, Unconjugated, E. coli
Artikelnummer: BIM-RPC20297
Hersteller Artikelnummer: RPC20297
Alternativnummer: BIM-RPC20297-20UG,BIM-RPC20297-100UG,BIM-RPC20297-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Reptile
Konjugation: Unconjugated
Alternative Synonym: Complement C3 homolog
Recombinant Naja kaouthia Cobra venom factor is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Naja kaouthia (Monocled cobra) (Naja siamensis). Target Name: Naja kaouthia Cobra venom factor. Target Synonyms: Complement C3 homolog. Accession Number: Q91132. Expression Region: 733~984aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 44.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 44.4kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: DDNEDGFIADSDIISRSDFPKSWLWLTKDLTEEPNSQGISSKTMSFYLRDSITTWVVLAVSFTPTKGICVAEPYEIRVMKVFFIDLQMPYSVVKNEQVEIRAILHNYVNEDIYVRVELLYNPAFCSASTKGQRYRQQFPIKALSSRAVPFVIVPLEQGLHDVEIKASVQEALWSDGVRKKLKVVPEGVQKSIVTIVKLDPRAKGVGGTQLEVIKARKLDDRVPDTEIETKIIIQGDPVAQIIENSIDGSKLN
Target-Kategorie: Naja kaouthia Cobra venom factor