Recombinant Naja kaouthia Cobra venom factor, Unconjugated, E. coli

Catalog Number: BIM-RPC20297
Article Name: Recombinant Naja kaouthia Cobra venom factor, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20297
Supplier Catalog Number: RPC20297
Alternative Catalog Number: BIM-RPC20297-20UG,BIM-RPC20297-100UG,BIM-RPC20297-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Reptile
Conjugation: Unconjugated
Alternative Names: Complement C3 homolog
Recombinant Naja kaouthia Cobra venom factor is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Naja kaouthia (Monocled cobra) (Naja siamensis). Target Name: Naja kaouthia Cobra venom factor. Target Synonyms: Complement C3 homolog. Accession Number: Q91132. Expression Region: 733~984aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 44.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 44.4kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: DDNEDGFIADSDIISRSDFPKSWLWLTKDLTEEPNSQGISSKTMSFYLRDSITTWVVLAVSFTPTKGICVAEPYEIRVMKVFFIDLQMPYSVVKNEQVEIRAILHNYVNEDIYVRVELLYNPAFCSASTKGQRYRQQFPIKALSSRAVPFVIVPLEQGLHDVEIKASVQEALWSDGVRKKLKVVPEGVQKSIVTIVKLDPRAKGVGGTQLEVIKARKLDDRVPDTEIETKIIIQGDPVAQIIENSIDGSKLN
Target: Naja kaouthia Cobra venom factor