Recombinant E. coli O157:H7 DNA-binding protein HU-alpha (hupA), Unconjugated

Artikelnummer: BIM-RPC20307
Artikelname: Recombinant E. coli O157:H7 DNA-binding protein HU-alpha (hupA), Unconjugated
Artikelnummer: BIM-RPC20307
Hersteller Artikelnummer: RPC20307
Alternativnummer: BIM-RPC20307-20UG,BIM-RPC20307-100UG,BIM-RPC20307-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: E. coli
Konjugation: Unconjugated
Alternative Synonym: HU-2NS2
Recombinant E. coli O157:H7 DNA-binding protein HU-alpha (hupA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli O157:H7. Target Name: hupA. Target Synonyms: HU-2NS2. Accession Number: P0ACF2. Expression Region: 1~90aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 25.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 25.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK
Target-Kategorie: hupA