Recombinant E. coli O157:H7 DNA-binding protein HU-alpha (hupA), Unconjugated

Catalog Number: BIM-RPC20307
Article Name: Recombinant E. coli O157:H7 DNA-binding protein HU-alpha (hupA), Unconjugated
Biozol Catalog Number: BIM-RPC20307
Supplier Catalog Number: RPC20307
Alternative Catalog Number: BIM-RPC20307-20UG,BIM-RPC20307-100UG,BIM-RPC20307-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: E. coli
Conjugation: Unconjugated
Alternative Names: HU-2NS2
Recombinant E. coli O157:H7 DNA-binding protein HU-alpha (hupA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli O157:H7. Target Name: hupA. Target Synonyms: HU-2NS2. Accession Number: P0ACF2. Expression Region: 1~90aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 25.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 25.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK
Target: hupA