Recombinant Human Zymogen granule protein 16 homolog B (ZG16B), Unconjugated, Yeast

Artikelnummer: BIM-RPC20326
Artikelname: Recombinant Human Zymogen granule protein 16 homolog B (ZG16B), Unconjugated, Yeast
Artikelnummer: BIM-RPC20326
Hersteller Artikelnummer: RPC20326
Alternativnummer: BIM-RPC20326-20UG,BIM-RPC20326-100UG,BIM-RPC20326-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: ZG16B, UNQ773/PRO1567Zymogen granule protein 16 homolog B
Recombinant Human Zymogen granule protein 16 homolog B (ZG16B) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ZG16B. Target Synonyms: ZG16B, UNQ773/PRO1567Zymogen granule protein 16 homolog B. Accession Number: Q96DA0. Expression Region: 53~208aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 19.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 19.2kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR
Target-Kategorie: ZG16B