Recombinant Human Zymogen granule protein 16 homolog B (ZG16B), Unconjugated, Yeast

Catalog Number: BIM-RPC20326
Article Name: Recombinant Human Zymogen granule protein 16 homolog B (ZG16B), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC20326
Supplier Catalog Number: RPC20326
Alternative Catalog Number: BIM-RPC20326-20UG,BIM-RPC20326-100UG,BIM-RPC20326-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: ZG16B, UNQ773/PRO1567Zymogen granule protein 16 homolog B
Recombinant Human Zymogen granule protein 16 homolog B (ZG16B) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ZG16B. Target Synonyms: ZG16B, UNQ773/PRO1567Zymogen granule protein 16 homolog B. Accession Number: Q96DA0. Expression Region: 53~208aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 19.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 19.2kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR
Target: ZG16B