Recombinant Human High mobility group protein B1 (HMGB1), partial, Unconjugated, Yeast

Artikelnummer: BIM-RPC20328
Artikelname: Recombinant Human High mobility group protein B1 (HMGB1), partial, Unconjugated, Yeast
Artikelnummer: BIM-RPC20328
Hersteller Artikelnummer: RPC20328
Alternativnummer: BIM-RPC20328-20UG,BIM-RPC20328-100UG,BIM-RPC20328-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: High mobility group protein 1HMG-1
Recombinant Human High mobility group protein B1 (HMGB1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Hmgb1. Target Synonyms: High mobility group protein 1HMG-1. Accession Number: P09429. Expression Region: 2~215aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 26.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 26.8kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
Target-Kategorie: Hmgb1