Recombinant Human High mobility group protein B1 (HMGB1), partial, Unconjugated, Yeast

Catalog Number: BIM-RPC20328
Article Name: Recombinant Human High mobility group protein B1 (HMGB1), partial, Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC20328
Supplier Catalog Number: RPC20328
Alternative Catalog Number: BIM-RPC20328-20UG,BIM-RPC20328-100UG,BIM-RPC20328-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: High mobility group protein 1HMG-1
Recombinant Human High mobility group protein B1 (HMGB1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Hmgb1. Target Synonyms: High mobility group protein 1HMG-1. Accession Number: P09429. Expression Region: 2~215aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 26.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 26.8kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
Target: Hmgb1