Recombinant Human Cytochrome P450 11B2, mitochondrial (CYP11B2), Unconjugated, E. coli

Artikelnummer: BIM-RPC20338
Artikelname: Recombinant Human Cytochrome P450 11B2, mitochondrial (CYP11B2), Unconjugated, E. coli
Artikelnummer: BIM-RPC20338
Hersteller Artikelnummer: RPC20338
Alternativnummer: BIM-RPC20338-20UG,BIM-RPC20338-100UG,BIM-RPC20338-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Aldosterone synthase (EC:1.14.15.4, EC:1.14.15.5)ALDOSAldosterone-synthesizing enzymeCYPXIB2Cytochrome P-450AldoCytochrome P-450C18Steroid 18-hydroxylase
Recombinant Human Cytochrome P450 11B2, mitochondrial (CYP11B2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CYP11B2. Target Synonyms: Aldosterone synthase (EC:1.14.15.4, EC:1.14.15.5)ALDOSAldosterone-synthesizing enzymeCYPXIB2Cytochrome P-450AldoCytochrome P-450C18Steroid 18-hydroxylase. Accession Number: P19099. Expression Region: 25~503aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 71kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 71kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELA
Target-Kategorie: CYP11B2