Recombinant Human Cytochrome P450 11B2, mitochondrial (CYP11B2), Unconjugated, E. coli

Catalog Number: BIM-RPC20338
Article Name: Recombinant Human Cytochrome P450 11B2, mitochondrial (CYP11B2), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20338
Supplier Catalog Number: RPC20338
Alternative Catalog Number: BIM-RPC20338-20UG,BIM-RPC20338-100UG,BIM-RPC20338-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Aldosterone synthase (EC:1.14.15.4, EC:1.14.15.5)ALDOSAldosterone-synthesizing enzymeCYPXIB2Cytochrome P-450AldoCytochrome P-450C18Steroid 18-hydroxylase
Recombinant Human Cytochrome P450 11B2, mitochondrial (CYP11B2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CYP11B2. Target Synonyms: Aldosterone synthase (EC:1.14.15.4, EC:1.14.15.5)ALDOSAldosterone-synthesizing enzymeCYPXIB2Cytochrome P-450AldoCytochrome P-450C18Steroid 18-hydroxylase. Accession Number: P19099. Expression Region: 25~503aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 71kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 71kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELA
Target: CYP11B2