Recombinant Human Retinal dehydrogenase 2 (ALDH1A2), Unconjugated, Yeast

Artikelnummer: BIM-RPC20347
Artikelname: Recombinant Human Retinal dehydrogenase 2 (ALDH1A2), Unconjugated, Yeast
Artikelnummer: BIM-RPC20347
Hersteller Artikelnummer: RPC20347
Alternativnummer: BIM-RPC20347-20UG,BIM-RPC20347-100UG,BIM-RPC20347-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Aldehyde dehydrogenase family 1 member A2Retinaldehyde-specific dehydrogenase type 2RALDH(II)
Recombinant Human Retinal dehydrogenase 2 (ALDH1A2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ALDH1A2. Target Synonyms: Aldehyde dehydrogenase family 1 member A2Retinaldehyde-specific dehydrogenase type 2RALDH(II). Accession Number: O94788. Expression Region: 1~518aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 58.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 58.7kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIG
Target-Kategorie: ALDH1A2