Recombinant Human Retinal dehydrogenase 2 (ALDH1A2), Unconjugated, Yeast

Catalog Number: BIM-RPC20347
Article Name: Recombinant Human Retinal dehydrogenase 2 (ALDH1A2), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC20347
Supplier Catalog Number: RPC20347
Alternative Catalog Number: BIM-RPC20347-20UG,BIM-RPC20347-100UG,BIM-RPC20347-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Aldehyde dehydrogenase family 1 member A2Retinaldehyde-specific dehydrogenase type 2RALDH(II)
Recombinant Human Retinal dehydrogenase 2 (ALDH1A2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ALDH1A2. Target Synonyms: Aldehyde dehydrogenase family 1 member A2Retinaldehyde-specific dehydrogenase type 2RALDH(II). Accession Number: O94788. Expression Region: 1~518aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 58.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 58.7kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIG
Target: ALDH1A2