Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC20352
Artikelname: Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC20352
Hersteller Artikelnummer: RPC20352
Alternativnummer: BIM-RPC20352-20UG,BIM-RPC20352-100UG,BIM-RPC20352-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: c-epsilon RI-alphaFcERIIgE Fc receptor subunit alpha
Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: FCER1A. Target Synonyms: c-epsilon RI-alphaFcERIIgE Fc receptor subunit alpha. Accession Number: P12319. Expression Region: 26~205aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 37kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 37kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ
Target-Kategorie: FCER1A