Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A), partial, Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A), partial, Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC20352
• Supplier Catalog Number: RPC20352
• Alternative Catalog Number: BIM-RPC20352-20UG,BIM-RPC20352-100UG,BIM-RPC20352-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: c-epsilon RI-alphaFcERIIgE Fc receptor subunit alpha

Product Description

Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: FCER1A. Target Synonyms: c-epsilon RI-alphaFcERIIgE Fc receptor subunit alpha. Accession Number: P12319. Expression Region: 26~205aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 37kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Properties

• Molecular Weight: 37kDa
• Tag: N-Terminal 6Xhis-Sumo-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% by SDS-PAGE
• Sequence: VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ
• Target: FCER1A