Recombinant Hafnia alvei Intimin (eaeA), Unconjugated, E. coli

Artikelnummer: BIM-RPC20354
Artikelname: Recombinant Hafnia alvei Intimin (eaeA), Unconjugated, E. coli
Artikelnummer: BIM-RPC20354
Hersteller Artikelnummer: RPC20354
Alternativnummer: BIM-RPC20354-20UG,BIM-RPC20354-100UG,BIM-RPC20354-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Attaching and effacing proteinOuter membrane protein
Recombinant Hafnia alvei Intimin (eaeA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Hafnia alvei. Target Name: eaeA. Target Synonyms: Attaching and effacing proteinOuter membrane protein. Accession Number: P52869. Expression Region: 1~280aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 46.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 46.1kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: ITEIKADKTTAVANGKDAVTYTVKVMKDGKPLSGEEVTFTTTLGTLSKSTEKTNTNGYRKVSLTSANQGKSLVSASVTMPQLMLKLLEVEFFTQLTIDNGNVEIVGTGAKGKLPNVWLQYGQVNLKANGGNGKYTWYSANPAIASVDPSSGQVTLKDKGETTITVVSGDKQTAIYTIAMPNSIVSVNSSGRVDYNTANNICKNIKGSLPSSIKELKDLYDDWGAANKYQHYSQESITAWTLQTSENKVQGVASTY
Target-Kategorie: eaeA