Recombinant Hafnia alvei Intimin (eaeA), Unconjugated, E. coli

Catalog Number: BIM-RPC20354
Article Name: Recombinant Hafnia alvei Intimin (eaeA), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20354
Supplier Catalog Number: RPC20354
Alternative Catalog Number: BIM-RPC20354-20UG,BIM-RPC20354-100UG,BIM-RPC20354-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Attaching and effacing proteinOuter membrane protein
Recombinant Hafnia alvei Intimin (eaeA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Hafnia alvei. Target Name: eaeA. Target Synonyms: Attaching and effacing proteinOuter membrane protein. Accession Number: P52869. Expression Region: 1~280aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 46.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 46.1kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: ITEIKADKTTAVANGKDAVTYTVKVMKDGKPLSGEEVTFTTTLGTLSKSTEKTNTNGYRKVSLTSANQGKSLVSASVTMPQLMLKLLEVEFFTQLTIDNGNVEIVGTGAKGKLPNVWLQYGQVNLKANGGNGKYTWYSANPAIASVDPSSGQVTLKDKGETTITVVSGDKQTAIYTIAMPNSIVSVNSSGRVDYNTANNICKNIKGSLPSSIKELKDLYDDWGAANKYQHYSQESITAWTLQTSENKVQGVASTY
Target: eaeA