Recombinant Bacillus subtilis Penicillin-binding protein 3 (pbpC), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC20360
Artikelname: Recombinant Bacillus subtilis Penicillin-binding protein 3 (pbpC), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC20360
Hersteller Artikelnummer: RPC20360
Alternativnummer: BIM-RPC20360-20UG,BIM-RPC20360-100UG,BIM-RPC20360-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: PBP 3PSPB20Penicillin-binding protein C
Recombinant Bacillus subtilis Penicillin-binding protein 3 (pbpC), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus subtilis (strain 168). Target Name: pbpC. Target Synonyms: PBP 3PSPB20Penicillin-binding protein C. Accession Number: P42971. Expression Region: 21~240aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 29.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 29.2kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: CSKTDSPEDRMEAFVKQWNDQQFDDMYQSLTKDVKKEISKKDFVNRYKAIYEQAGVKNLKVTAGEVDKDDQDNKTMKHIPYKVSMNTNAGKVSFKNTAVLKLEKTDDEESWNIDWDPSFIFKQLADDKTVQIMSIEPKRGQIYDKNGKGLAVNTDVPEIGIVPGELGDKKEKVIKELAKKLDLTEDDIKKKLDQGWVKDDSFVPLKKVKPDQEKLVSEAT
Target-Kategorie: pbpC