Recombinant Bacillus subtilis Penicillin-binding protein 3 (pbpC), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC20360
Article Name: Recombinant Bacillus subtilis Penicillin-binding protein 3 (pbpC), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20360
Supplier Catalog Number: RPC20360
Alternative Catalog Number: BIM-RPC20360-20UG,BIM-RPC20360-100UG,BIM-RPC20360-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: PBP 3PSPB20Penicillin-binding protein C
Recombinant Bacillus subtilis Penicillin-binding protein 3 (pbpC), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus subtilis (strain 168). Target Name: pbpC. Target Synonyms: PBP 3PSPB20Penicillin-binding protein C. Accession Number: P42971. Expression Region: 21~240aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 29.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 29.2kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: CSKTDSPEDRMEAFVKQWNDQQFDDMYQSLTKDVKKEISKKDFVNRYKAIYEQAGVKNLKVTAGEVDKDDQDNKTMKHIPYKVSMNTNAGKVSFKNTAVLKLEKTDDEESWNIDWDPSFIFKQLADDKTVQIMSIEPKRGQIYDKNGKGLAVNTDVPEIGIVPGELGDKKEKVIKELAKKLDLTEDDIKKKLDQGWVKDDSFVPLKKVKPDQEKLVSEAT
Target: pbpC