Recombinant Bacillus subtilis Penicillin-binding protein 4 (pbpE), Unconjugated, E. coli

Artikelnummer: BIM-RPC20368
Artikelname: Recombinant Bacillus subtilis Penicillin-binding protein 4 (pbpE), Unconjugated, E. coli
Artikelnummer: BIM-RPC20368
Hersteller Artikelnummer: RPC20368
Alternativnummer: BIM-RPC20368-20UG,BIM-RPC20368-100UG,BIM-RPC20368-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: PBP 4*PBP 4APenicillin-binding protein E
Recombinant Bacillus subtilis Penicillin-binding protein 4 (pbpE) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus subtilis (strain 168). Target Name: pbpE. Target Synonyms: PBP 4*PBP 4APenicillin-binding protein E. Accession Number: P32959. Expression Region: 1~451aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 67.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 67.4kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MKQNKRKHLQTLFETLGEKHQFNGTVLAAEGGDILYHHSFGYAEMTEKRPLKTNSLFELASLSKPFTALGIILLEEKGILGYEDKVDRWLPGFPYQGVTIRHLLNHTSGLPDYMGWFFANWDSHKIAVNQDIVDMLMNEGLSGYFEPNEGWMYSNTGYVLLAVIIEKASGMSYADFIKTSIFLPAGMNETRVYNRRLSPERIDHYAYGYVYDVHSETYVLPDELEETNYVVYLDGIQGDGTVNSVTSDLFRFDQA
Target-Kategorie: pbpE