Recombinant Bacillus subtilis Penicillin-binding protein 4 (pbpE), Unconjugated, E. coli

Catalog Number: BIM-RPC20368
Article Name: Recombinant Bacillus subtilis Penicillin-binding protein 4 (pbpE), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20368
Supplier Catalog Number: RPC20368
Alternative Catalog Number: BIM-RPC20368-20UG,BIM-RPC20368-100UG,BIM-RPC20368-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: PBP 4*PBP 4APenicillin-binding protein E
Recombinant Bacillus subtilis Penicillin-binding protein 4 (pbpE) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus subtilis (strain 168). Target Name: pbpE. Target Synonyms: PBP 4*PBP 4APenicillin-binding protein E. Accession Number: P32959. Expression Region: 1~451aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 67.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 67.4kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MKQNKRKHLQTLFETLGEKHQFNGTVLAAEGGDILYHHSFGYAEMTEKRPLKTNSLFELASLSKPFTALGIILLEEKGILGYEDKVDRWLPGFPYQGVTIRHLLNHTSGLPDYMGWFFANWDSHKIAVNQDIVDMLMNEGLSGYFEPNEGWMYSNTGYVLLAVIIEKASGMSYADFIKTSIFLPAGMNETRVYNRRLSPERIDHYAYGYVYDVHSETYVLPDELEETNYVVYLDGIQGDGTVNSVTSDLFRFDQA
Target: pbpE