Recombinant Arabidopsis thaliana NADPH-dependent oxidoreductase 2-alkenal reductase (AER), Unconjugated, E. coli

Artikelnummer: BIM-RPC20377
Artikelname: Recombinant Arabidopsis thaliana NADPH-dependent oxidoreductase 2-alkenal reductase (AER), Unconjugated, E. coli
Artikelnummer: BIM-RPC20377
Hersteller Artikelnummer: RPC20377
Alternativnummer: BIM-RPC20377-20UG,BIM-RPC20377-100UG,BIM-RPC20377-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: A. thaliana
Konjugation: Unconjugated
Alternative Synonym: DBR1
Recombinant Arabidopsis thaliana NADPH-dependent oxidoreductase 2-alkenal reductase (AER) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress). Target Name: AER. Target Synonyms: DBR1. Accession Number: Q39172. Expression Region: 1~345aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 54.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 54.1kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MTATNKQVILKDYVSGFPTESDFDFTTTTVELRVPEGTNSVLVKNLYLSCDPYMRIRMGKPDPSTAALAQAYTPGQPIQGYGVSRIIESGHPDYKKGDLLWGIVAWEEYSVITPMTHAHFKIQHTDVPLSYYTGLLGMPGMTAYAGFYEVCSPKEGETVYVSAASGAVGQLVGQLAKMMGCYVVGSAGSKEKVDLLKTKFGFDDAFNYKEESDLTAALKRCFPNGIDIYFENVGGKMLDAVLVNMNMHGRIAVCG
Target-Kategorie: AER