Recombinant Arabidopsis thaliana NADPH-dependent oxidoreductase 2-alkenal reductase (AER), Unconjugated, E. coli

Catalog Number: BIM-RPC20377
Article Name: Recombinant Arabidopsis thaliana NADPH-dependent oxidoreductase 2-alkenal reductase (AER), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20377
Supplier Catalog Number: RPC20377
Alternative Catalog Number: BIM-RPC20377-20UG,BIM-RPC20377-100UG,BIM-RPC20377-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: A. thaliana
Conjugation: Unconjugated
Alternative Names: DBR1
Recombinant Arabidopsis thaliana NADPH-dependent oxidoreductase 2-alkenal reductase (AER) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress). Target Name: AER. Target Synonyms: DBR1. Accession Number: Q39172. Expression Region: 1~345aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 54.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 54.1kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MTATNKQVILKDYVSGFPTESDFDFTTTTVELRVPEGTNSVLVKNLYLSCDPYMRIRMGKPDPSTAALAQAYTPGQPIQGYGVSRIIESGHPDYKKGDLLWGIVAWEEYSVITPMTHAHFKIQHTDVPLSYYTGLLGMPGMTAYAGFYEVCSPKEGETVYVSAASGAVGQLVGQLAKMMGCYVVGSAGSKEKVDLLKTKFGFDDAFNYKEESDLTAALKRCFPNGIDIYFENVGGKMLDAVLVNMNMHGRIAVCG
Target: AER