Recombinant Helicobacter pylori DNA protection during starvation protein (dps), Unconjugated, E. coli

Artikelnummer: BIM-RPC20384
Artikelname: Recombinant Helicobacter pylori DNA protection during starvation protein (dps), Unconjugated, E. coli
Artikelnummer: BIM-RPC20384
Hersteller Artikelnummer: RPC20384
Alternativnummer: BIM-RPC20384-20UG,BIM-RPC20384-100UG,BIM-RPC20384-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: H. pylori
Konjugation: Unconjugated
Alternative Synonym: BacterioferritinHP-NAPNeutrophil-activating protein ANAP A
Recombinant Helicobacter pylori DNA protection during starvation protein (dps) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori). Target Name: dps. Target Synonyms: BacterioferritinHP-NAPNeutrophil-activating protein ANAP A. Accession Number: P43313. Expression Region: 1~144aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 32.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 32.9kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEEFADMFDDLAERIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKYLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA
Target-Kategorie: dps