Recombinant Helicobacter pylori DNA protection during starvation protein (dps), Unconjugated, E. coli

Catalog Number: BIM-RPC20384
Article Name: Recombinant Helicobacter pylori DNA protection during starvation protein (dps), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20384
Supplier Catalog Number: RPC20384
Alternative Catalog Number: BIM-RPC20384-20UG,BIM-RPC20384-100UG,BIM-RPC20384-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: H. pylori
Conjugation: Unconjugated
Alternative Names: BacterioferritinHP-NAPNeutrophil-activating protein ANAP A
Recombinant Helicobacter pylori DNA protection during starvation protein (dps) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori). Target Name: dps. Target Synonyms: BacterioferritinHP-NAPNeutrophil-activating protein ANAP A. Accession Number: P43313. Expression Region: 1~144aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 32.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 32.9kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEEFADMFDDLAERIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKYLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA
Target: dps