Recombinant Lassa virus Nucleoprotein (N), Unconjugated, E. coli

Artikelnummer: BIM-RPC20386
Artikelname: Recombinant Lassa virus Nucleoprotein (N), Unconjugated, E. coli
Artikelnummer: BIM-RPC20386
Hersteller Artikelnummer: RPC20386
Alternativnummer: BIM-RPC20386-20UG,BIM-RPC20386-100UG,BIM-RPC20386-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: Nucleocapsid proteinProtein N
Recombinant Lassa virus Nucleoprotein (N) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV). Target Name: N. Target Synonyms: Nucleocapsid proteinProtein N. Accession Number: P13699. Expression Region: 1~569aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 79kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 79kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MSASKEIKSFLWTQSLRRELSGYCSNIKLQVVKDAQALLHGLDFSEVSNVQRLMRKERRDDNDLKRLRDLNQAVNNLVELKSTQQKSILRVGTLTSDDLLILAADLEKLKSKVIRTERPLSAGVYMGNLSSQQLDQRRALLNMIGMSGGNQGARAGRDGVVRVWDVKNAELLNNQFGTMPSLTLACLTKQGQVDLNDAVQALTDLGLIYTAKYPNTSDLDRLTQSHPILNMIDTKKSSLNISGYNFSLGAAVKAG
Target-Kategorie: N