Recombinant Lassa virus Nucleoprotein (N), Unconjugated, E. coli

Catalog Number: BIM-RPC20386
Article Name: Recombinant Lassa virus Nucleoprotein (N), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20386
Supplier Catalog Number: RPC20386
Alternative Catalog Number: BIM-RPC20386-20UG,BIM-RPC20386-100UG,BIM-RPC20386-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: Nucleocapsid proteinProtein N
Recombinant Lassa virus Nucleoprotein (N) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV). Target Name: N. Target Synonyms: Nucleocapsid proteinProtein N. Accession Number: P13699. Expression Region: 1~569aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 79kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 79kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MSASKEIKSFLWTQSLRRELSGYCSNIKLQVVKDAQALLHGLDFSEVSNVQRLMRKERRDDNDLKRLRDLNQAVNNLVELKSTQQKSILRVGTLTSDDLLILAADLEKLKSKVIRTERPLSAGVYMGNLSSQQLDQRRALLNMIGMSGGNQGARAGRDGVVRVWDVKNAELLNNQFGTMPSLTLACLTKQGQVDLNDAVQALTDLGLIYTAKYPNTSDLDRLTQSHPILNMIDTKKSSLNISGYNFSLGAAVKAG
Target: N