Recombinant Dog Inactive pancreatic lipase-related protein 1 (PNLIPRP1), Unconjugated, E. coli

Artikelnummer: BIM-RPC20388
Artikelname: Recombinant Dog Inactive pancreatic lipase-related protein 1 (PNLIPRP1), Unconjugated, E. coli
Artikelnummer: BIM-RPC20388
Hersteller Artikelnummer: RPC20388
Alternativnummer: BIM-RPC20388-20UG,BIM-RPC20388-100UG,BIM-RPC20388-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Canine
Konjugation: Unconjugated
Alternative Synonym: PL-RP1
Recombinant Dog Inactive pancreatic lipase-related protein 1 (PNLIPRP1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Dog (Canis familiaris, Canine). Target Name: PNLIPRP1. Target Synonyms: PL-RP1. Accession Number: P06857. Expression Region: 18~467aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 65.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 65.7kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: KEVCYEQIGCFSDAEPWAGTAIRPLKVLPWSPERIGTRFLLYTNKNPNNFQTLLPSDPSTIEASNFQTDKKTRFIIHGFIDKGEENWLLDMCKNMFKVEEVNCICVDWKKGSQTSYTQAANNVRVVGAQVAQMLSMLSANYSYSPSQVQLIGHSLGAHVAGEAGSRTPGLGRITGLDPVEASFQGTPEEVRLDPTDADFVDVIHTDAAPLIPFLGFGTSQQMGHLDFFPNGGEEMPGCKKNALSQIVDLDGIWEG
Target-Kategorie: PNLIPRP1