Recombinant Dog Inactive pancreatic lipase-related protein 1 (PNLIPRP1), Unconjugated, E. coli

Catalog Number: BIM-RPC20388
Article Name: Recombinant Dog Inactive pancreatic lipase-related protein 1 (PNLIPRP1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20388
Supplier Catalog Number: RPC20388
Alternative Catalog Number: BIM-RPC20388-20UG,BIM-RPC20388-100UG,BIM-RPC20388-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Canine
Conjugation: Unconjugated
Alternative Names: PL-RP1
Recombinant Dog Inactive pancreatic lipase-related protein 1 (PNLIPRP1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Dog (Canis familiaris, Canine). Target Name: PNLIPRP1. Target Synonyms: PL-RP1. Accession Number: P06857. Expression Region: 18~467aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 65.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 65.7kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: KEVCYEQIGCFSDAEPWAGTAIRPLKVLPWSPERIGTRFLLYTNKNPNNFQTLLPSDPSTIEASNFQTDKKTRFIIHGFIDKGEENWLLDMCKNMFKVEEVNCICVDWKKGSQTSYTQAANNVRVVGAQVAQMLSMLSANYSYSPSQVQLIGHSLGAHVAGEAGSRTPGLGRITGLDPVEASFQGTPEEVRLDPTDADFVDVIHTDAAPLIPFLGFGTSQQMGHLDFFPNGGEEMPGCKKNALSQIVDLDGIWEG
Target: PNLIPRP1