Recombinant Aspergillus niger Aspergillopepsin-2, Unconjugated, E. coli

Artikelnummer: BIM-RPC20396
Artikelname: Recombinant Aspergillus niger Aspergillopepsin-2, Unconjugated, E. coli
Artikelnummer: BIM-RPC20396
Hersteller Artikelnummer: RPC20396
Alternativnummer: BIM-RPC20396-20UG,BIM-RPC20396-100UG,BIM-RPC20396-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Fungi
Konjugation: Unconjugated
Alternative Synonym: Acid protease AAspergillopepsin IIProctase A
Recombinant Aspergillus niger Aspergillopepsin-2 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Aspergillus niger. Target Name: Aspergillus niger Aspergillopepsin-2. Target Synonyms: Acid protease AAspergillopepsin IIProctase A. Accession Number: P24665. Expression Region: 60~98aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 19.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 19.9kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: EEYSSNWAGAVLIGDGYTKVTGEFTVPSVSAGSSGSSGY
Target-Kategorie: Aspergillus niger Aspergillopepsin-2