Recombinant Aspergillus niger Aspergillopepsin-2 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Aspergillus niger. Target Name: Aspergillus niger Aspergillopepsin-2. Target Synonyms: Acid protease AAspergillopepsin IIProctase A. Accession Number: P24665. Expression Region: 60~98aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 19.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight:
19.9kDa
Tag:
N-Terminal 6Xhis-Sumo-Tagged
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity:
>90% by SDS-PAGE
Sequence:
EEYSSNWAGAVLIGDGYTKVTGEFTVPSVSAGSSGSSGY
Target:
Aspergillus niger Aspergillopepsin-2
* VAT and and shipping costs not included. Errors and price changes excepted
