Recombinant Hesperocyparis arizonica Pectate lyase 1, Unconjugated, E. coli

Artikelnummer: BIM-RPC20402
Artikelname: Recombinant Hesperocyparis arizonica Pectate lyase 1, Unconjugated, E. coli
Artikelnummer: BIM-RPC20402
Hersteller Artikelnummer: RPC20402
Alternativnummer: BIM-RPC20402-20UG,BIM-RPC20402-100UG,BIM-RPC20402-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Plant
Konjugation: Unconjugated
Alternative Synonym: Major pollen allergen Cup a 1Allergen: Cup a 1
Recombinant Hesperocyparis arizonica Pectate lyase 1 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Hesperocyparis arizonica (Arizona cypress) (Cupressus arizonica). Target Name: Hesperocyparis arizonica Pectate lyase 1. Target Synonyms: Major pollen allergen Cup a 1Allergen: Cup a 1. Accession Number: Q9SCG9. Expression Region: 22~367aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 42.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 42.6kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADVHLGNGGPCLFMRKASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGG
Target-Kategorie: Hesperocyparis arizonica Pectate lyase 1