Recombinant Hesperocyparis arizonica Pectate lyase 1, Unconjugated, E. coli

Catalog Number: BIM-RPC20402
Article Name: Recombinant Hesperocyparis arizonica Pectate lyase 1, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20402
Supplier Catalog Number: RPC20402
Alternative Catalog Number: BIM-RPC20402-20UG,BIM-RPC20402-100UG,BIM-RPC20402-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Plant
Conjugation: Unconjugated
Alternative Names: Major pollen allergen Cup a 1Allergen: Cup a 1
Recombinant Hesperocyparis arizonica Pectate lyase 1 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Hesperocyparis arizonica (Arizona cypress) (Cupressus arizonica). Target Name: Hesperocyparis arizonica Pectate lyase 1. Target Synonyms: Major pollen allergen Cup a 1Allergen: Cup a 1. Accession Number: Q9SCG9. Expression Region: 22~367aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 42.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 42.6kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADVHLGNGGPCLFMRKASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGG
Target: Hesperocyparis arizonica Pectate lyase 1