Recombinant Chicken Homeobox protein engrailed-1 (EN1), Unconjugated, E. coli

Artikelnummer: BIM-RPC20415
Artikelname: Recombinant Chicken Homeobox protein engrailed-1 (EN1), Unconjugated, E. coli
Artikelnummer: BIM-RPC20415
Hersteller Artikelnummer: RPC20415
Alternativnummer: BIM-RPC20415-20UG,BIM-RPC20415-100UG,BIM-RPC20415-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Gallus
Konjugation: Unconjugated
Alternative Synonym: Gg-En-1Homeobox protein en-1
Recombinant Chicken Homeobox protein engrailed-1 (EN1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Chicken (Gallus). Target Name: EN1. Target Synonyms: Gg-En-1Homeobox protein en-1. Accession Number: Q05916. Expression Region: 1~333aa. Tag Info: N-Terminal 6Xhis-B2M-Tagged. Theoretical MW: 48.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 48.5kDa
Tag: N-Terminal 6Xhis-B2M-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MEEPPEGHGHHRDAAPPGPANGGGGGGGGSDGDSAPVSPSPAPASPAAPCPLPLPRRRPPPPPPPRTTNFFIDNILRPDFGCKKEPPAATGAATGAGGGGGGGGREQRDGAQSAGRENVNPLLARPPHAPSSALLCPDSNCAPDGSAPAGTAAKANPGTAAGAAGAAGAAKAQGDGGETPAAKYGEHGSPAILLMGSNNGGAVLKPDSQQPLVWPAWVYCTRYSDRPSSPRTRKLKKKKTEKEDKRPRTAFTAEQ
Target-Kategorie: EN1