Recombinant Chicken Homeobox protein engrailed-1 (EN1), Unconjugated, E. coli

Catalog Number: BIM-RPC20415
Article Name: Recombinant Chicken Homeobox protein engrailed-1 (EN1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20415
Supplier Catalog Number: RPC20415
Alternative Catalog Number: BIM-RPC20415-20UG,BIM-RPC20415-100UG,BIM-RPC20415-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Gallus
Conjugation: Unconjugated
Alternative Names: Gg-En-1Homeobox protein en-1
Recombinant Chicken Homeobox protein engrailed-1 (EN1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Chicken (Gallus). Target Name: EN1. Target Synonyms: Gg-En-1Homeobox protein en-1. Accession Number: Q05916. Expression Region: 1~333aa. Tag Info: N-Terminal 6Xhis-B2M-Tagged. Theoretical MW: 48.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 48.5kDa
Tag: N-Terminal 6Xhis-B2M-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MEEPPEGHGHHRDAAPPGPANGGGGGGGGSDGDSAPVSPSPAPASPAAPCPLPLPRRRPPPPPPPRTTNFFIDNILRPDFGCKKEPPAATGAATGAGGGGGGGGREQRDGAQSAGRENVNPLLARPPHAPSSALLCPDSNCAPDGSAPAGTAAKANPGTAAGAAGAAGAAKAQGDGGETPAAKYGEHGSPAILLMGSNNGGAVLKPDSQQPLVWPAWVYCTRYSDRPSSPRTRKLKKKKTEKEDKRPRTAFTAEQ
Target: EN1